Structure of PDB 6ndk Chain QO

Receptor sequence
>6ndkQO (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB6ndk Importance of a tRNA anticodon loop modification and a conserved, noncanonical anticodon stem pairing intRNACGGProfor decoding
ChainQO
Resolution3.64 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna QO P2 K5 K8 Q9 F18 D21 T22 G23 Q28 L31 R35 H42 H46 D49 H50 H51 S52 R54 L57 M58 M59 G61 R65 Y69 R72 P1 K4 K7 Q8 F17 D20 T21 G22 Q27 L30 R34 H41 H45 D48 H49 H50 S51 R53 L56 M57 M58 G60 R64 Y68 R71
BS02 rna QO K44 L56 R64 G89 K43 L55 R63 G88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6ndk, PDBe:6ndk, PDBj:6ndk
PDBsum6ndk
PubMed30782843
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]