Structure of PDB 5vpp Chain QM

Receptor sequence
>5vppQM (length=114) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRK
3D structure
PDB5vpp Mechanism of tRNA-mediated +1 ribosomal frameshifting.
ChainQM
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna QM R14 Y21 I22 Y23 G24 I25 G26 A28 R29 R44 Y87 R91 L96 P97 V98 R99 G100 Q101 R102 T103 R104 T105 N106 R108 T109 R114 K115 R13 Y20 I21 Y22 G23 I24 G25 A27 R28 R43 Y86 R90 L95 P96 V97 R98 G99 Q100 R101 T102 R103 T104 N105 R107 T108 R113 K114
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vpp, PDBe:5vpp, PDBj:5vpp
PDBsum5vpp
PubMed30262649
UniProtP80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]