Structure of PDB 4lt8 Chain QL

Receptor sequence

>4lt8QL (length=125) Species: 300852 (Thermus thermophilus HB8)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEAA

3D structure

• PDB: 4lt8 Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
• Chain: QL
• Resolution: 3.14 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QL	P5 T6 N8 Q9 R12 R15 E16 K17 K20 K28 G29 A30 P31 F32 R33 R34 K46 K47 N49 S50 A51 R53 K54 T61 Y69 P71 E73 R86 G87 V90 K91 D92 R97 R113 K114 K115 S116 R117 S118 K119 T122 K123 K124	P1 T2 N4 Q5 R8 R11 E12 K13 K16 K24 G25 A26 P27 F28 R29 R30 K42 K43 N45 S46 A47 R49 K50 T57 Y65 P67 E69 R82 G83 V86 K87 D88 R93 R109 K110 K111 S112 R113 S114 K115 T118 K119 K120

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4lt8, PDBe:4lt8, PDBj:4lt8
• PDBsum: 4lt8
• PubMed: 25128388
• UniProt: Q5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)