Structure of PDB 6o3m Chain QK

Receptor sequence
>6o3mQK (length=119) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYA
AQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVD
DTPVPHNGCRPKKKFRKAS
3D structure
PDB6o3m Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
ChainQK
Resolution3.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna QK Y20 H22 N26 N27 I29 N38 P39 I40 W42 S44 G46 G52 S53 K55 R85 V114 P115 H116 N117 G118 C119 R120 P121 K122 K123 K124 Y10 H12 N16 N17 I19 N28 P29 I30 W32 S34 G36 G42 S43 K45 R75 V104 P105 H106 N107 G108 C109 R110 P111 K112 K113 K114
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6o3m, PDBe:6o3m, PDBj:6o3m
PDBsum6o3m
PubMed33016876
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]