Structure of PDB 6nsh Chain QK

Receptor sequence
>6nshQK (length=116) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAA
QLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDD
TPVPHNGCRPKKKFRK
3D structure
PDB6nsh Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
ChainQK
Resolution3.397 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna QK Y20 H22 N26 N27 I29 T31 N38 P39 I40 W42 S44 G46 V47 G52 S53 K55 R85 P113 H116 N117 G118 C119 R120 P121 K122 K123 K124 Y9 H11 N15 N16 I18 T20 N27 P28 I29 W31 S33 G35 V36 G41 S42 K44 R74 P102 H105 N106 G107 C108 R109 P110 K111 K112 K113
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nsh, PDBe:6nsh, PDBj:6nsh
PDBsum6nsh
PubMed33016876
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]