Structure of PDB 4yzv Chain QK

Receptor sequence

>4yzvQK (length=121) Species: 300852 (Thermus thermophilus HB8)

KVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTP
YAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSI
VDDTPVPHNGCRPKKKFRKAS

3D structure

• PDB: 4yzv Defining the mRNA recognition signature of a bacterial toxin protein.
• Chain: QK
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QK	Y20 N26 N27 I29 T31 G37 N38 P39 W42 S44 G46 G52 S53 K55 R85 T87 V114 P115 H116 N117 G118 C119 R120 K122 K123 K124 S129	Y12 N18 N19 I21 T23 G29 N30 P31 W34 S36 G38 G44 S45 K47 R77 T79 V106 P107 H108 N109 G110 C111 R112 K114 K115 K116 S121
BS02	rna	QK	K9 K11	K1 K3
BS03	MG	QK	N26 G52	N18 G44

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4yzv, PDBe:4yzv, PDBj:4yzv
• PDBsum: 4yzv
• PubMed: 26508639
• UniProt: P80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)