Structure of PDB 6buw Chain QJ

Receptor sequence

>6buwQJ (length=99) Species: 300852 (Thermus thermophilus HB8)

KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRG
PFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTV

3D structure

• PDB: 6buw Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
• Chain: QJ
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QJ	R5 R9 H13 D17 G36 P37 I38 P39 P41 T42 R43 V44 R45 R46 T48 R51 G52 P53 F54 K55 H56 K57 S59 R60 H68 R70 D73	R3 R7 H11 D15 G34 P35 I36 P37 P39 T40 R41 V42 R43 R44 T46 R49 G50 P51 F52 K53 H54 K55 S57 R58 H66 R68 D71
BS02	rna	QJ	R29 K80	R27 K78
BS03	MG	QJ	P91 T92 G93	P89 T90 G91

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6buw, PDBe:6buw, PDBj:6buw
• PDBsum: 6buw
• PubMed: 30476222
• UniProt: Q5SHN7|RS10_THET8 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)