Structure of PDB 4zsn Chain QI

Receptor sequence

>4zsnQI (length=128) Species: 300852 (Thermus thermophilus HB8)

MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPL
RAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLG
FLTRDARVVERKKYGKHKARRAPQYSKR

3D structure

• PDB: 4zsn Mechanism of endonuclease cleavage by the HigB toxin.
• Chain: QI
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QI	M1 T7 R9 R10 K11 E12 V14 R16 F18 Y36 Q38 Y62 R66 G67 G68 G69 K70 S71 Q73 R93 K97 R104 A106 R107 V108 V109 E110 R111 K112 K113 Y114 G115 H117 K118 R120 R121 A122 P123 Q124 K127 R128	M1 T7 R9 R10 K11 E12 V14 R16 F18 Y36 Q38 Y62 R66 G67 G68 G69 K70 S71 Q73 R93 K97 R104 A106 R107 V108 V109 E110 R111 K112 K113 Y114 G115 H117 K118 R120 R121 A122 P123 Q124 K127 R128
BS02	rna	QI	K127 R128	K127 R128

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4zsn, PDBe:4zsn, PDBj:4zsn
• PDBsum: 4zsn
• PubMed: 27378776
• UniProt: P80374|RS9_THET8 Small ribosomal subunit protein uS9 (Gene Name=rpsI)