Structure of PDB 4w4g Chain QE

Receptor sequence
>4w4gQE (length=154) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEV
PLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVI
AGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERL
RKGE
3D structure
PDB4w4g Defining the mRNA recognition signature of a bacterial toxin protein.
ChainQE
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna QE R14 T16 A17 R18 M19 Q20 A21 G22 R24 R25 R27 K47 K57 A86 K92 A94 A95 T98 I101 A102 L119 T120 K121 E122 S125 R126 N127 N130 R13 T15 A16 R17 M18 Q19 A20 G21 R23 R24 R26 K46 K56 A85 K91 A93 A94 T97 I100 A101 L118 T119 K120 E121 S124 R125 N126 N129
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w4g, PDBe:4w4g, PDBj:4w4g
PDBsum4w4g
PubMed26508639
UniProtQ5SHQ5|RS5_THET8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]