Structure of PDB 6osi Chain QD

Receptor sequence

>6osiQD (length=208) Species: 300852 (Thermus thermophilus HB8)

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

• PDB: 6osi Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
• Chain: QD
• Resolution: 4.14 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QD	G2 C9 R10 R13 R14 K22 R25 K30 R35 R36 Y38 P40 G41 H43 Y54 Q62 R65 S71 R73 Q74 K84 K85 K86 G87 R115 Q116 R118 Q119 R122 V133 D134 L135 P136 E205 S208 R209	G1 C8 R9 R12 R13 K21 R24 K29 R34 R35 Y37 P39 G40 H42 Y53 Q61 R64 S70 R72 Q73 K83 K84 K85 G86 R114 Q115 R117 Q118 R121 V132 D133 L134 P135 E204 S207 R208
BS02	SF4	QD	C9 C12 K18 L19 K22 C26 C31 M33	C8 C11 K17 L18 K21 C25 C30 M32

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6osi, PDBe:6osi, PDBj:6osi
• PDBsum: 6osi
• PubMed: 33016876
• UniProt: P80373|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)