Structure of PDB 6nta Chain QC

Receptor sequence

>6ntaQC (length=205) Species: 300852 (Thermus thermophilus HB8)

GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAG
LARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVAL
NVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKV
IVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAY
IFLGE

3D structure

• PDB: 6nta Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
• Chain: QC
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QC	G2 N3 K4 I5 F10 K26 S154 R156 E161 Q162 A163 G171 R172 V173 P174 L175 H176 T177 L178 R179 F186 T192 Y193 G194 V195 K199	G1 N2 K3 I4 F9 K25 S153 R155 E160 Q161 A162 G170 R171 V172 P173 L174 H175 T176 L177 R178 F185 T191 Y192 G193 V194 K198
BS02	MG	QC	R59 A60	R58 A59

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6nta, PDBe:6nta, PDBj:6nta
• PDBsum: 6nta
• PubMed: 33016876
• UniProt: P80372|RS3_THET8 Small ribosomal subunit protein uS3 (Gene Name=rpsC)