Structure of PDB 6bok Chain QB

Receptor sequence

>6bokQB (length=141) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDFGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

PDB

6bok Conformational Control of Translation Termination on the 70S Ribosome.

Chain

Resolution

3.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QB	P4 R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 K18 K22 G24 Y26 F29 A40 W41 Q46 A49 R56 R67 F69 D71 Y74 K77 E80 R82 M83 G84 K85 G86 K87 G88 R101 R119 H123 K124 P126 K128	P4 R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 K18 K22 G24 Y26 F29 A40 W41 Q46 A49 R56 R67 F69 D71 Y74 K77 E80 R82 M83 G84 K85 G86 K87 G88 R101 R119 H123 K124 P126 K128
BS02	rna	QB	R16 G19	R16 G19

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6bok, PDBe:6bok, PDBj:6bok
PDBsum	6bok
PubMed	29731232
UniProt	Q72I11\|RL16_THET2 Large ribosomal subunit protein uL16 (Gene Name=rplP)