Structure of PDB 7y7a Chain QA

Receptor sequence

>7y7aQA (length=174) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

AFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASCMVS
DAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAGDAS
VLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERKMSF
AAGDCTSLASEVASYFDRVGAAIS

3D structure

PDB

7y7a In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.

Chain

Resolution

4.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	QA	D23 A26	D20 A23
BS02	PEB	QA	N72 R77 R78 A81 C82 R84 D85 L120 V122 P123	N69 R74 R75 A78 C79 R81 D82 L117 V119 P120
BS03	PEB	QA	K28 N35 K36 L38 D39 I142 F153 A154 G156 C158	K25 N32 K33 L35 D36 I139 F150 A151 G153 C155
BS04	PEB	QA	C50 C61 I133 Q137 F141 E148	C47 C58 I130 Q134 F138 E145
BS05	PEB	QA	S12 D13 K15	S9 D10 K12

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7y7a, PDBe:7y7a, PDBj:7y7a
PDBsum	7y7a
PubMed	36922595
UniProt	P11393\|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]