Structure of PDB 4wzo Chain Q8

Receptor sequence
>4wzoQ8 (length=60) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLL
3D structure
PDB4wzo Structural insights into the translational infidelity mechanism.
ChainQ8
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Q8 P2 K3 M4 K5 H7 K8 K12 R13 T17 A18 M25 K26 G28 K29 R30 H31 L32 W34 K36 K39 E40 R42 K44 R46 V49 E54 L60 P1 K2 M3 K4 H6 K7 K11 R12 T16 A17 M24 K25 G27 K28 R29 H30 L31 W33 K35 K38 E39 R41 K43 R45 V48 E53 L59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4wzo, PDBe:4wzo, PDBj:4wzo
PDBsum4wzo
PubMed26037619
UniProtQ5SKU1|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]