Structure of PDB 4wzd Chain Q8

Receptor sequence

>4wzdQ8 (length=62) Species: 300852 (Thermus thermophilus HB8)

PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLLLP

3D structure

• PDB: 4wzd Structural insights into the translational infidelity mechanism.
• Chain: Q8
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q8	P2 K3 M4 K5 T6 K8 K11 K12 R13 K15 T17 A18 S19 K21 K26 T27 K29 R30 H31 L32 N33 W34 K39 R42 Q43 K44 R46 K47 F48 A51 K52 P53 L62	P1 K2 M3 K4 T5 K7 K10 K11 R12 K14 T16 A17 S18 K20 K25 T26 K28 R29 H30 L31 N32 W33 K38 R41 Q42 K43 R45 K46 F47 A50 K51 P52 L61

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wzd, PDBe:4wzd, PDBj:4wzd
• PDBsum: 4wzd
• PubMed: 26037619
• UniProt: Q5SKU1|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)