Structure of PDB 4wsd Chain Q8

Receptor sequence
>4wsdQ8 (length=60) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLL
3D structure
PDB4wsd Structural insights into the translational infidelity mechanism.
ChainQ8
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q8 P2 K3 M4 K5 K8 K12 R13 T17 A18 M25 K26 G28 K29 R30 H31 K36 K39 E40 R42 K44 R46 F48 A51 E54 K59 L60 P1 K2 M3 K4 K7 K11 R12 T16 A17 M24 K25 G27 K28 R29 H30 K35 K38 E39 R41 K43 R45 F47 A50 E53 K58 L59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wsd, PDBe:4wsd, PDBj:4wsd
PDBsum4wsd
PubMed26037619
UniProtQ5SKU1|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]