Structure of PDB 5m1j Chain Q5

Receptor sequence

>5m1jQ5 (length=185) Species: 4932 (Saccharomyces cerevisiae)

GIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKA
LFLSKINRPPVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTV
AALRFTAGARAKIVKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVR
HFGMGPHKGKAPRILSTGRKFERARGRRRSKGFKV

3D structure

• PDB: 5m1j Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.
• Chain: Q5
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q5	G2 I3 H5 S7 K8 Q9 H10 K11 R12 G14 H15 R16 K20 S21 K31 F35 R38 R39 P43 F44 L54 S55 K56 P61 S63 S65 R66 R69 Q73 T86 T88 D89 D90 R92 I93 R105 T107 A108 N136 T137 I139 R141 G142 P143 R144 N145 S146 R147 E148 R151 F153 P157 G160 A162 R164 S167 R170 K171 F172 E173 R176 R179 R180 S181 K182 F184 K185	G1 I2 H4 S6 K7 Q8 H9 K10 R11 G13 H14 R15 K19 S20 K30 F34 R37 R38 P42 F43 L53 S54 K55 P60 S62 S64 R65 R68 Q72 T85 T87 D88 D89 R91 I92 R104 T106 A107 N135 T136 I138 R140 G141 P142 R143 N144 S145 R146 E147 R150 F152 P156 G159 A161 R163 S166 R169 K170 F171 E172 R175 R178 R179 S180 K181 F183 K184
BS02	MG	Q5	A149 F153	A148 F152
BS03	MG	Q5	R16 L54 S55 N58	R15 L53 S54 N57

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5m1j, PDBe:5m1j, PDBj:5m1j
• PDBsum: 5m1j
• PubMed: 27995908
• UniProt: P0CX49|RL18A_YEAST Large ribosomal subunit protein eL18A (Gene Name=RPL18A)