Structure of PDB 6gzx Chain Q4

Receptor sequence

>6gzxQ4 (length=100) Species: 300852 (Thermus thermophilus HB8)

PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKR

3D structure

• PDB: 6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
• Chain: Q4
• Resolution: 4.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q4	P2 K3 K4 S12 D13 K14 M15 K17 T18 K34 K37 R38 Y42 E61 S62 R63 P64 I65 S66 K67 R68 K69 R70 R72 R81 K87 R91 R92 N94 Y95 E96 L98 S99 K100 R101	P1 K2 K3 S11 D12 K13 M14 K16 T17 K33 K36 R37 Y41 E60 S61 R62 P63 I64 S65 K66 R67 K68 R69 R71 R80 K86 R90 R91 N93 Y94 E95 L97 S98 K99 R100

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gzx, PDBe:6gzx, PDBj:6gzx
• PDBsum: 6gzx
• PubMed: 30301898
• UniProt: P0DOY7|RS17_THET8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)