Structure of PDB 6zvk Chain Q3

Receptor sequence
>6zvkQ3 (length=63) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
KSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSVFMASHFDR
HYCGKCCLTYCFN
3D structure
PDB6zvk The Halastavi arva Virus Intergenic Region IRES Promotes Translation by the Simplest Possible Initiation Mechanism.
ChainQ3
Resolution3.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q3 K2 S3 Y4 T6 K8 K9 H12 K13 R14 K16 V17 K18 L19 A20 F50 H54 F55 D56 R57 Y59 G61 K62 T66 K1 S2 Y3 T5 K7 K8 H11 K12 R13 K15 V16 K17 L18 A19 F43 H47 F48 D49 R50 Y52 G54 K55 T59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zvk, PDBe:6zvk, PDBj:6zvk
PDBsum6zvk
PubMed33296660
UniProtP79781|RS27A_CHICK Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=RPS27A)

[Back to BioLiP]