Structure of PDB 7r81 Chain Q2

Receptor sequence

>7r81Q2 (length=127) Species: 5141 (Neurospora crassa) [Search protein sequence]

GIDLDALLDLGSDELRDVVHARARRRINRGLKRKPMGLIKKLRKAKQEAK
PNEKPDLVKTHLRDMIVVPEMIGSVIGIYSGKEFNQVEIKPEMVGHYLAE
FSISYKPVKHGRPGIGATHSSRFIPLK

3D structure

PDB

7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Q2	H45 A46 R47 R49 R50 R54 K57 R58 K84 H86 R88 D89 G106 K107 Y122 A124 E125 S129 Y130 V133 H135 G136 R137 K152	H20 A21 R22 R24 R25 R29 K32 R33 K59 H61 R63 D64 G81 K82 Y97 A99 E100 S104 Y105 V108 H110 G111 R112 K127
BS02	rna	Q2	I140 I149 K152	I115 I124 K127
BS03	rna	Q2	T143 H144 S145 F148	T118 H119 S120 F123

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links