Structure of PDB 6gzq Chain Q2

Receptor sequence
>6gzqQ2 (length=100) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKR
3D structure
PDB6gzq Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
ChainQ2
Resolution3.28 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q2 P2 K3 K4 S12 D13 K14 M15 T18 R25 Y32 K37 S39 K40 K41 S62 R63 I65 S66 K67 K69 R70 R72 R81 K87 R91 N94 Y95 L98 S99 K100 R101 P1 K2 K3 S11 D12 K13 M14 T17 R24 Y31 K36 S38 K39 K40 S61 R62 I64 S65 K66 K68 R69 R71 R80 K86 R90 N93 Y94 L97 S98 K99 R100
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gzq, PDBe:6gzq, PDBj:6gzq
PDBsum6gzq
PubMed30301898
UniProtP0DOY7|RS17_THET8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]