Structure of PDB 5lyb Chain Q2

Receptor sequence

>5lybQ2 (length=105) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QALQF

3D structure

PDB

5lyb ?

Chain

Resolution

3.25 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Q2	V2 N3 P5 R8 K9 T10 Y11 K13 K19 H20 Y28 A30 G31 K32 A33 F36 A37 Q38 G39 R41 R45 K46 G49 F50 G51 G52 Q53 T54 K55 P56 V57 F58 K60 K61 A62 K63 T65 K66 K67 R80 Q82 T84 K86 C88 K89 K97 K98	V1 N2 P4 R7 K8 T9 Y10 K12 K18 H19 Y27 A29 G30 K31 A32 F35 A36 Q37 G38 R40 R44 K45 G48 F49 G50 G51 Q52 T53 K54 P55 V56 F57 K59 K60 A61 K62 T64 K65 K66 R79 Q81 T83 K85 C87 K88 K96 K97
BS02	ZN	Q2	C17 C77	C16 C76
BS03	OHX	Q2	K46 S48 F50	K45 S47 F49

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5lyb, PDBe:5lyb, PDBj:5lyb
PDBsum	5lyb
PubMed	27827794
UniProt	P0CX27\|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)