Structure of PDB 4u4z Chain Q2

Receptor sequence

>4u4zQ2 (length=105) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QALQF

3D structure

PDB

4u4z ?

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Q2	V2 N3 P5 R8 K9 T10 Y11 K13 K19 H20 Y28 A30 G31 K32 A33 F36 A37 Q38 G39 R41 R45 K46 G49 F50 G52 Q53 T54 K55 P56 V57 F58 K60 A62 K63 T65 K67 R80 Q82 T84 K86 C88 K89 K97 K98	V1 N2 P4 R7 K8 T9 Y10 K12 K18 H19 Y27 A29 G30 K31 A32 F35 A36 Q37 G38 R40 R44 K45 G48 F49 G51 Q52 T53 K54 P55 V56 F57 K59 A61 K62 T64 K66 R79 Q81 T83 K85 C87 K88 K96 K97
BS02	3K5	Q2	K40 Y43 K55 V57 F58	K39 Y42 K54 V56 F57
BS03	ZN	Q2	C17 C77	C16 C76
BS04	OHX	Q2	K46 S48 F50	K45 S47 F49

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4u4z, PDBe:4u4z, PDBj:4u4z
PDBsum	4u4z
PubMed	25209664
UniProt	P0CX27\|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)