Structure of PDB 7oyc Chain Q1

Receptor sequence

>7oycQ1 (length=180) Species: 8355 (Xenopus laevis)

GIDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSSFNRVVLKRL
FMSRTNRPPLSMSRLIRKMKLQGRENKTAVVVGCITDDVRIHDIPKLKVC
ALKITSGARSRILKAGGQIMTFDQLALAAPKGQNTVLLSGPRKAREVYRH
FGKAPGTPHSRTKPYVLSKGRKFERARGRR

3D structure

• PDB: 7oyc A molecular network of conserved factors keeps ribosomes dormant in the egg.
• Chain: Q1
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q1	G2 I3 H7 N8 D10 R11 K12 V13 R14 R15 K19 S20 Q21 K30 F34 R37 R38 S42 F43 R45 R50 M53 S54 R55 T56 N57 P60 S62 S64 R65 R68 K69 K71 L72 Q73 R75 K78 C85 T87 D88 D89 V90 R91 K104 T106 S107 S111 L114 K115 G133 Q134 N135 T136 L138 S140 R143 K144 A145 R146 E147 V148 R150 F152 G153 K154 T158 P159 H160 R162 T163 K164 Y166 S169 K170 R172 K173 F174 R176 R178 R181	G1 I2 H6 N7 D9 R10 K11 V12 R13 R14 K18 S19 Q20 K29 F33 R36 R37 S41 F42 R44 R49 M52 S53 R54 T55 N56 P59 S61 S63 R64 R67 K68 K70 L71 Q72 R74 K77 C84 T86 D87 D88 V89 R90 K103 T105 S106 S110 L113 K114 G132 Q133 N134 T135 L137 S139 R142 K143 A144 R145 E146 V147 R149 F151 G152 K153 T157 P158 H159 R161 T162 K163 Y165 S168 K169 R171 K172 F173 R175 R177 R180

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 18:54:26 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7oyc', asym_id = 'Q1', title = 'A molecular network of conserved factors keeps ribosomes dormant in the egg.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7oyc', asym_id='Q1', title='A molecular network of conserved factors keeps ribosomes dormant in the egg.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7oyc', asym_id = 'Q1'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7oyc', asym_id='Q1')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>