Structure of PDB 8bn3 Chain Q0

Receptor sequence
>8bn3Q0 (length=51) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
IEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKKL
K
3D structure
PDB8bn3 Evolving precision: rRNA Expansion Segment 7S enhances translation accuracy in eukaryal ribosomes
ChainQ0
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q0 R97 Y100 R102 P104 R106 N109 R111 K112 R113 K114 C115 G116 H117 N119 R122 K124 K125 R20 Y23 R25 P27 R29 N32 R34 K35 R36 K37 C38 G39 H40 N42 R45 K47 K48
BS02 ZN Q0 C96 C99 C110 C115 C19 C22 C33 C38
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bn3, PDBe:8bn3, PDBj:8bn3
PDBsum8bn3
PubMed38324474
UniProtP0CH08|RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein (Gene Name=RPL40A)

[Back to BioLiP]