Structure of PDB 5dgv Chain Q0

Receptor sequence
>5dgvQ0 (length=52) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
IIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKK
LK
3D structure
PDB5dgv Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
ChainQ0
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q0 K93 V95 R97 Y100 R102 T108 N109 R111 K112 R113 K114 G116 H117 N119 R122 K124 K125 K17 V19 R21 Y24 R26 T32 N33 R35 K36 R37 K38 G40 H41 N43 R46 K48 K49
BS02 ZN Q0 C96 C110 C20 C34
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dgv, PDBe:5dgv, PDBj:5dgv
PDBsum5dgv
PubMed
UniProtP0CH08|RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein (Gene Name=RPL40A)

[Back to BioLiP]