Structure of PDB 9cg6 Chain Q

Receptor sequence
>9cg6Q (length=79) Species: 562 (Escherichia coli) [Search protein sequence]
KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNEC
GIGDVVEIRECRPLSKTKSWTLVRVVEKA
3D structure
PDB9cg6 Structural analysis of noncanonical translation initiation complexes.
ChainQ
Resolution2.61 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q K4 R6 K16 M17 E18 K19 S20 R27 F28 K36 R40 T41 T42 L44 H45 E63 R65 P66 L67 S68 K69 T70 K71 S72 W73 K1 R3 K13 M14 E15 K16 S17 R24 F25 K33 R37 T38 T39 L41 H42 E60 R62 P63 L64 S65 K66 T67 K68 S69 W70
External links