Structure of PDB 9bkd Chain Q

Receptor sequence

>9bkdQ (length=99) Species: 9606 (Homo sapiens)

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPR

3D structure

• PDB: 9bkd Human tumor suppressor protein Pdcd4 binds at the mRNA entry channel in the 40S small ribosomal subunit.
• Chain: Q
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	T2 K3 K4 R5 R6 N7 N8 G9 R10 K13 G14 R15 G16 H17 R28 K32 K34 K37 K38 F39 Y68 K70 V75 S76 I79 H80 K82 V83 V84 R85 N86 R87 S88 R89 R92 K93 R95 P97 P98 R100	T1 K2 K3 R4 R5 N6 N7 G8 R9 K12 G13 R14 G15 H16 R27 K31 K33 K36 K37 F38 Y67 K69 V74 S75 I78 H79 K81 V82 V83 R84 N85 R86 S87 R88 R91 K92 R94 P96 P97 R99
BS02	ZN	Q	C23 C26 C77	C22 C25 C76

External links

• PDB: RCSB:9bkd, PDBe:9bkd, PDBj:9bkd
• PDBsum: 9bkd
• PubMed: 39117603
• UniProt: P62854|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)