Structure of PDB 8wdv Chain Q

Receptor sequence
>8wdvQ (length=43) Species: 572477 (Allochromatium vinosum DSM 180) [Search protein sequence]
MHKIWQIFDPRRTLVALFGFLFVLGLLIHFILLSSPAFNWLSG
3D structure
PDB8wdv High-resolution structure and biochemical properties of the LH1-RC photocomplex from the model purple sulfur bacterium, Allochromatium vinosum
ChainQ
Resolution2.24 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CRT Q F26 L30 H33 F34 F22 L26 H29 F30
BS02 BCL Q F22 L25 F26 H33 W44 F18 L21 F22 H29 W40
BS03 BCL Q L25 L28 G29 I32 H33 L21 L24 G25 I28 H29
BS04 CRT Q L21 F22 F24 L25 L17 F18 F20 L21
BS05 BCL Q M5 I32 M1 I28
BS06 CRT Q K7 I8 K3 I4
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wdv, PDBe:8wdv, PDBj:8wdv
PDBsum8wdv
PubMed38347078
UniProtD3RP69

[Back to BioLiP]