Structure of PDB 8wao Chain Q |
>8waoQ (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] |
TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMGQVEEEP LNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGR DYIFSKAIGDAEW |
|
PDB | 8wao Structural Visualization of de novo Transcription Initiation. |
Chain | Q |
Resolution | 6.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
Q |
R344 K346 |
R81 K83 |
|
|
|
|