Structure of PDB 8wan Chain Q

Receptor sequence

>8wanQ (length=113) Species: 9606 (Homo sapiens) [Search protein sequence]

TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMGQVEEEP
LNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGR
DYIFSKAIGDAEW

3D structure

PDB

8wan Structural Visualization of de novo Transcription Initiation.

Chain

Resolution

6.07 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	Q	R344 K346	R81 K83

Gene Ontology

	Molecular Function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding
GO:0001091	RNA polymerase II general transcription initiation factor binding
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0016251	RNA polymerase II general transcription initiation factor activity
GO:0017025	TBP-class protein binding
GO:0046982	protein heterodimerization activity
GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding

	Biological Process
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051123	RNA polymerase II preinitiation complex assembly
GO:0060261	positive regulation of transcription initiation by RNA polymerase II

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005669	transcription factor TFIID complex
GO:0005672	transcription factor TFIIA complex
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0097550	transcription preinitiation complex

External links

PDB	RCSB:8wan, PDBe:8wan, PDBj:8wan
PDBsum	8wan
PubMed	38127763
UniProt	P52655\|TF2AA_HUMAN Transcription initiation factor IIA subunit 1 (Gene Name=GTF2A1)