Structure of PDB 8wan Chain Q

Receptor sequence
>8wanQ (length=113) Species: 9606 (Homo sapiens) [Search protein sequence]
TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMGQVEEEP
LNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGR
DYIFSKAIGDAEW
3D structure
PDB8wan Structural Visualization of de novo Transcription Initiation.
ChainQ
Resolution6.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna Q R344 K346 R81 K83
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0001091 RNA polymerase II general transcription initiation factor binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017025 TBP-class protein binding
GO:0046982 protein heterodimerization activity
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0005672 transcription factor TFIIA complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8wan, PDBe:8wan, PDBj:8wan
PDBsum8wan
PubMed38127763
UniProtP52655|TF2AA_HUMAN Transcription initiation factor IIA subunit 1 (Gene Name=GTF2A1)

[Back to BioLiP]