Structure of PDB 8v87 Chain Q

Receptor sequence

>8v87Q (length=127) Species: 1247190 (Saccharomyces cerevisiae BY4741)

APKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKALFLSKINRPPVSVSRI
ARALKQEGAANKTVVVVGTVTDDARIFEFPKTTVAALRFTAGARAKIVKA
GGECITLDQLAVRAPKGQNTLILRGPR

3D structure

• PDB: 8v87 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.
• Chain: Q
• Resolution: 2.66 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	K20 S21 F35 R38 R39 P43 S55 K56 I57 P61 S63 S65 R66 R69 Q73 E74 K79 T86 T88 D89 D90 R92 I93 T107 A108 G134 Q135 N136 T137 I139 R141 R144	K3 S4 F18 R21 R22 P26 S38 K39 I40 P44 S46 S48 R49 R52 Q56 E57 K62 T69 T71 D72 D73 R75 I76 T90 A91 G117 Q118 N119 T120 I122 R124 R127

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8v87, PDBe:8v87, PDBj:8v87
• PDBsum: 8v87
• PubMed: 38632236
• UniProt: P0CX49|RL18A_YEAST Large ribosomal subunit protein eL18A (Gene Name=RPL18A)