Structure of PDB 8urx Chain Q

Receptor sequence
>8urxQ (length=117) Species: 562 (Escherichia coli) [Search protein sequence]
RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRRV
3D structure
PDB8urx Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome
ChainQ
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Q H22 N28 N29 T33 G39 N40 A41 W44 T46 G48 G49 R53 G54 S55 K57 K87 P115 I116 P117 H118 N119 G120 C121 R122 P124 K125 R127 R128 H10 N16 N17 T21 G27 N28 A29 W32 T34 G36 G37 R41 G42 S43 K45 K75 P103 I104 P105 H106 N107 G108 C109 R110 P112 K113 R115 R116
Gene Ontology
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8urx, PDBe:8urx, PDBj:8urx
PDBsum8urx
PubMed39117885
UniProtB7MCR3|RS11_ECO45 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]