Structure of PDB 8s8g Chain Q

Receptor sequence

>8s8gQ (length=141) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPL
LLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSK
NELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR

3D structure

• PDB: 8s8g Structural basis of AUC codon discrimination during translation initiation in yeast.
• Chain: Q
• Resolution: 4.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	Q8 T9 F10 K12 K13 K14 S15 H21 K23 G33 E42 R66 K68 T70 G71 G72 G73 H74 V75 S76 Q77 R122 R123 E125 P126 K128 F129 G133 A134 R135 S136 R137 Q139 K140 Y142 R143	Q6 T7 F8 K10 K11 K12 S13 H19 K21 G31 E40 R64 K66 T68 G69 G70 G71 H72 V73 S74 Q75 R120 R121 E123 P124 K126 F127 G131 A132 R133 S134 R135 Q137 K138 Y140 R141

External links

• PDB: RCSB:8s8g, PDBe:8s8g, PDBj:8s8g
• PDBsum: 8s8g
• PubMed: 39193907
• UniProt: Q875N2|RS16_KLULA Small ribosomal subunit protein uS9 (Gene Name=RPS16)