Structure of PDB 8rg0 Chain Q

Receptor sequence

>8rg0Q (length=96) Species: 9606 (Homo sapiens) [Search protein sequence]

RRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDIS
EASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPR

3D structure

PDB

8rg0 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining

Chain

Resolution

3.4 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Q	R42 H80	R38 H76
BS02	rna	Q	R5 R6 N7 G9 A11 K13 G14 R15 G16 H17 Q19 K32 K34 K37 K38 F39 V75 I79 K82 V84 R85 N86 R87 S88 R89 R92 K93 D94 R95 T96 P97 P98 R100	R1 R2 N3 G5 A7 K9 G10 R11 G12 H13 Q15 K28 K30 K33 K34 F35 V71 I75 K78 V80 R81 N82 R83 S84 R85 R88 K89 D90 R91 T92 P93 P94 R96
BS03	ZN	Q	C23 C26 C74 C77	C19 C22 C70 C73

External links

PDB	RCSB:8rg0, PDBe:8rg0, PDBj:8rg0
PDBsum	8rg0
PubMed
UniProt	P62854\|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)