Structure of PDB 8r57 Chain Q

Receptor sequence

>8r57Q (length=145) Species: 4565 (Triticum aestivum) [Search protein sequence]

VLTRPTPGTVQCFGRKKTAVAVAYCKPGRGLIKVNGAPIELIRPEMLRLK
AFEPILLAGRSRFKDIDMRIRVRGGGKTSQIYSIRQAIAKSLVAYYQKYV
DEAAKKEVKEIFGRYDRTLLVADPRRCEPKKFGGRGARARFQKSY

3D structure

PDB

8r57 High-Resolution Structure and Internal Mobility of a Plant 40S Ribosomal Subunit.

Chain

Resolution

2.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	Q14 C15 F16 R18 K19 K20 T21 V25 Y27 R32 R46 E48 R72 R74 R76 G77 G78 G79 K80 T81 S82 Q83 R120 V124 P127 R128 R129 C130 E131 P132 K133 K134 F135 R138 G139 R141 A142 R143 F144 Q145 K146 S147	Q11 C12 F13 R15 K16 K17 T18 V22 Y24 R29 R43 E45 R69 R71 R73 G74 G75 G76 K77 T78 S79 Q80 R117 V121 P124 R125 R126 C127 E128 P129 K130 K131 F132 R135 G136 R138 A139 R140 F141 Q142 K143 S144

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links