Structure of PDB 8q3v Chain Q

Receptor sequence
>8q3vQ (length=61) Species: 145263 (Methanothermobacter marburgensis) [Search protein sequence]
EEVKPVAPETALIEARMRNIQTQVKMIGSTNRMFAGMYSGKVQGIMIGLA
FTLTLGILLLV
3D structure
PDB8q3v Structural and mechanistic basis of the central energy-converting methyltransferase complex of methanogenesis.
ChainQ
Resolution2.08 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 JCV Q Y215 K218 Y38 K41
BS02 JCV Q I224 F228 I47 F51
BS03 JCV Q Q220 M223 L235 Q43 M46 L58
Gene Ontology
Molecular Function
GO:0008168 methyltransferase activity
GO:0030269 tetrahydromethanopterin S-methyltransferase activity
Biological Process
GO:0006730 one-carbon metabolic process
GO:0015948 methanogenesis
GO:0019386 methanogenesis, from carbon dioxide
GO:0032259 methylation
Cellular Component
GO:0005886 plasma membrane
GO:0034708 methyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q3v, PDBe:8q3v, PDBj:8q3v
PDBsum8q3v
PubMed38530900
UniProtP80184|MTRA1_METTM Tetrahydromethanopterin S-methyltransferase subunit A 1 (Gene Name=mtrA1)

[Back to BioLiP]