Structure of PDB 8pj1 Chain Q

Receptor sequence

>8pj1Q (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPR

3D structure

PDB

8pj1 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining

Chain

Resolution

3.4 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Q	I41 R42 N43 E46 R100	I40 R41 N42 E45 R99
BS02	rna	Q	T2 K3 K4 R5 R6 N7 N8 G9 R10 A11 K12 K13 G14 R15 G16 H17 Q19 K32 K34 K37 F39 V75 S76 I79 K82 V83 V84 R85 R87 S88 R89 R92 K93 R95 P97 P98	T1 K2 K3 R4 R5 N6 N7 G8 R9 A10 K11 K12 G13 R14 G15 H16 Q18 K31 K33 K36 F38 V74 S75 I78 K81 V82 V83 R84 R86 S87 R88 R91 K92 R94 P96 P97
BS03	ZN	Q	C26 C74	C25 C73

External links

PDB	RCSB:8pj1, PDBe:8pj1, PDBj:8pj1
PDBsum	8pj1
PubMed
UniProt	P62854\|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)