Structure of PDB 8p2h Chain Q

Receptor sequence

>8p2hQ (length=120) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

YRKLGRTSDQRKAMLRDLATSLIISERIETTEARAKEVRSVVEKLITLGK
KGDLASRRNAAKTLRNVEILNEDETTQTALQKLFGEIAERYTERQGGYTR
ILKQGPRRGDGAESVIIELV

3D structure

• PDB: 8p2h Staphylococcus aureus 70S ribosome with elongation factor G locked with fusidic acid with a tRNA in pe/E chimeric hybrid state
• Chain: Q
• Resolution: 2.49 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	Y3 R4 K5 G7 R8 S10 Q12 R13 K14 M16 R18 L20 S23 I30 E31 T32 T33 R36 K38 R41 S42 E45 K46 T49 L56 R59 R60 K64 R67 Q83 R96 Q97 G98 G99 T101 R102 K105 R109 R110 G111 D112 A114	Y1 R2 K3 G5 R6 S8 Q10 R11 K12 M14 R16 L18 S21 I28 E29 T30 T31 R34 K36 R39 S40 E43 K44 T47 L54 R57 R58 K62 R65 Q81 R94 Q95 G96 G97 T99 R100 K103 R107 R108 G109 D110 A112

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p2h, PDBe:8p2h, PDBj:8p2h
• PDBsum: 8p2h
• PubMed: 38902339
• UniProt: Q2FW33|RL17_STAA8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)