Structure of PDB 8p2f Chain Q

Receptor sequence

>8p2fQ (length=120) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

YRKLGRTSDQRKAMLRDLATSLIISERIETTEARAKEVRSVVEKLITLGK
KGDLASRRNAAKTLRNVEILNEDETTQTALQKLFGEIAERYTERQGGYTR
ILKQGPRRGDGAESVIIELV

3D structure

PDB

8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid

Chain

Resolution

2.44 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	Y3 R4 K5 G7 R8 S10 Q12 R13 K14 M16 L17 R18 L20 S23 I30 E31 T32 T33 R36 K38 R41 S42 E45 K46 T49 L56 R59 R60 R67 R96 Q97 G98 G99 T101 R102 K105 R109 R110 G111 D112 A114	Y1 R2 K3 G5 R6 S8 Q10 R11 K12 M14 L15 R16 L18 S21 I28 E29 T30 T31 R34 K36 R39 S40 E43 K44 T47 L54 R57 R58 R65 R94 Q95 G96 G97 T99 R100 K103 R107 R108 G109 D110 A112

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
PDBsum	8p2f
PubMed	38902339
UniProt	Q2FW33\|RL17_STAA8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)