Structure of PDB 8jpb Chain Q

Receptor sequence
>8jpbQ (length=317) Species: 9606 (Homo sapiens) [Search protein sequence]
RELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAM
QAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWN
DPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTT
GIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQ
VLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSH
LVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENI
RFVFAAVKDTILQLNLK
3D structure
PDB8jpb GPCR activation and GRK2 assembly by a biased intracellular agonist.
ChainQ
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP Q E49 G51 K52 S53 T54 D155 R181 V182 R183 N274 K275 D277 L278 C330 A331 T332 E12 G14 K15 S16 T17 D118 R144 V145 R146 N237 K238 D240 L241 C293 A294 T295
BS02 MG Q S53 T186 S16 T149
BS03 ALF Q G48 E49 T186 G207 G208 G11 E12 T149 G170 G171
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005096 GTPase activator activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019001 guanyl nucleotide binding
GO:0030234 enzyme regulator activity
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0046872 metal ion binding
Biological Process
GO:0001508 action potential
GO:0006469 negative regulation of protein kinase activity
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007206 phospholipase C-activating G protein-coupled glutamate receptor signaling pathway
GO:0007208 phospholipase C-activating serotonin receptor signaling pathway
GO:0007213 G protein-coupled acetylcholine receptor signaling pathway
GO:0007215 glutamate receptor signaling pathway
GO:0007218 neuropeptide signaling pathway
GO:0007596 blood coagulation
GO:0007603 phototransduction, visible light
GO:0009649 entrainment of circadian clock
GO:0010543 regulation of platelet activation
GO:0034695 response to prostaglandin E
GO:0050821 protein stabilization
GO:0060158 phospholipase C-activating dopamine receptor signaling pathway
GO:0060828 regulation of canonical Wnt signaling pathway
Cellular Component
GO:0001750 photoreceptor outer segment
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005765 lysosomal membrane
GO:0005794 Golgi apparatus
GO:0005834 heterotrimeric G-protein complex
GO:0005886 plasma membrane
GO:0031965 nuclear membrane
GO:0045202 synapse
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jpb, PDBe:8jpb, PDBj:8jpb
PDBsum8jpb
PubMed37532940
UniProtP50148|GNAQ_HUMAN Guanine nucleotide-binding protein G(q) subunit alpha (Gene Name=GNAQ)

[Back to BioLiP]