Structure of PDB 8ic3 Chain Q |
>8ic3Q (length=118) Species: 10090 (Mus musculus) [Search protein sequence] |
QLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKME FDTRERWENPLMGWASTADPLSNMVLTFSAKEDAIAFAEKNGWSYDVEEK KVPKPKSKSYGANFSWNK |
|
PDB | 8ic3 Respiratory complex Peripheral Arm of CI, focus-refined map of type I, PERK -/- mouse under cold temperature |
Chain | Q |
Resolution | 3.2 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
Q |
W166 N167 |
W116 N117 |
|
|
|