Structure of PDB 8i7j Chain Q

Receptor sequence

>8i7jQ (length=141) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]

TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPL
LLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSK
NELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR

3D structure

PDB

8i7j Yeast eukaryotic initiation factor 4B remodels the mRNA entry site on the small ribosomal subunit

Chain

Resolution

4.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	Q8 T9 F10 K14 T17 V19 H21 K30 R66 K68 G71 G72 G73 H74 R114 I118 S121 R122 R123 P124 E125 K128 A134 R135 S136 R137 Q139 K140 S141 Y142 R143	Q6 T7 F8 K12 T15 V17 H19 K28 R64 K66 G69 G70 G71 H72 R112 I116 S119 R120 R121 P122 E123 K126 A132 R133 S134 R135 Q137 K138 S139 Y140 R141

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8i7j, PDBe:8i7j, PDBj:8i7j
PDBsum	8i7j
PubMed
UniProt	Q875N2\|RS16_KLULA Small ribosomal subunit protein uS9 (Gene Name=RPS16)