Structure of PDB 8eup Chain Q

Receptor sequence

>8eupQ (length=134) Species: 4896 (Schizosaccharomyces pombe)

QRSKPASENVYLKLLVKLYRFLARRTDSRFNKAILKRLFQSKTNRPPISI
SKIAALTSRKSASSQNKTTVVVGTVTDDERMLTVPKLSIAALRFTKSARA
RILKAGGEVLTLDQLALRAPTGSNTVLVRGKKHA

3D structure

• PDB: 8eup Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Chain: Q
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	A19 S20 K30 R37 R38 R42 F43 S54 K55 T56 P60 S64 K65 R72 K73 T87 T89 D90 D91 E92 R93 T108 K109 G135 N137 V141 R142 G143 K145 A147	A6 S7 K17 R24 R25 R29 F30 S41 K42 T43 P47 S51 K52 R59 K60 T74 T76 D77 D78 E79 R80 T95 K96 G122 N124 V128 R129 G130 K132 A134

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8eup, PDBe:8eup, PDBj:8eup
• PDBsum: 8eup
• PubMed: 36423630
• UniProt: Q10192|RL18A_SCHPO Large ribosomal subunit protein eL18A (Gene Name=rpl1801)