Structure of PDB 8cgu Chain Q

Receptor sequence
>8cguQ (length=77) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]
RTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGI
GDVVEIRECRPLSKTKSWTLVRVVEKA
3D structure
PDB8cgu Structural conservation of antibiotic interaction with ribosomes.
ChainQ
Resolution1.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q R6 S14 K16 M17 E18 K19 S20 R27 F28 K36 F37 R40 T41 T42 K43 L44 H45 E63 R65 P66 L67 S68 K69 T70 K71 S72 W73 R1 S9 K11 M12 E13 K14 S15 R22 F23 K31 F32 R35 T36 T37 K38 L39 H40 E58 R60 P61 L62 S63 K64 T65 K66 S67 W68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cgu, PDBe:8cgu, PDBj:8cgu
PDBsum8cgu
PubMed37550453
UniProtP0AG63|RS17_ECOLI Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]