Structure of PDB 8cd1 Chain Q

Receptor sequence

>8cd1Q (length=117) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]

ARVKRGVIARRRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRR
QRKRQFRALWIARINAGARQNGLSYSRLIAGLKKAAIEIDRKVLADLAVN
EKAAFTAIVEKAKASLA

3D structure

PDB

8cd1 70S-PHIKZ014 PHIKZ phage protein occupied ribosome

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	A2 R3 V4 K5 R6 G7 I9 A10 R11 R13 H14 K19 G23 Y24 Y25 R30 V31 F32 R33 V34 K36 Q37 K41 A42 Y45 A46 Y47 R48 D49 R50 R51 R53 K54 R55 Q56 F57 R58 W61 I62 N66 R70 Y76 S77 R78 I80 A81 K84 D91 R92 K93	A1 R2 V3 K4 R5 G6 I8 A9 R10 R12 H13 K18 G22 Y23 Y24 R29 V30 F31 R32 V33 K35 Q36 K40 A41 Y44 A45 Y46 R47 D48 R49 R50 R52 K53 R54 Q55 F56 R57 W60 I61 N65 R69 Y75 S76 R77 I79 A80 K83 D90 R91 K92

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8cd1, PDBe:8cd1, PDBj:8cd1
PDBsum	8cd1
PubMed	38443577
UniProt	Q9I0A2\|RL20_PSEAE Large ribosomal subunit protein bL20 (Gene Name=rplT)