Structure of PDB 8agu Chain Q

Receptor sequence
>8aguQ (length=109) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
LKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAP
ELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKG
LQTVVVEED
3D structure
PDB8agu Molecular basis of eIF5A-dependent CAT tailing in eukaryotic ribosome-associated quality control.
ChainQ
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q R10 T13 N15 H17 K18 R19 H21 G22 V23 S24 F25 K26 K27 R28 R31 V33 K34 L51 N56 Q57 W60 R62 V64 K65 Y69 R70 K102 L104 Q105 T106 R7 T10 N12 H14 K15 R16 H18 G19 V20 S21 F22 K23 K24 R25 R28 V30 K31 L48 N53 Q54 W57 R59 V61 K62 Y66 R67 K99 L101 Q102 T103
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006450 regulation of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8agu, PDBe:8agu, PDBj:8agu
PDBsum8agu
PubMed36804914
UniProtP0C2H8|RL31A_YEAST Large ribosomal subunit protein eL31A (Gene Name=RPL31A)

[Back to BioLiP]