Structure of PDB 7zmb Chain Q |
>7zmbQ (length=85) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] |
EGLQKVEVYERIKSLLAGFDKVNDPNNITETAHFANDLGLDSLDTVEVVM AIEEEFSIEIPDKDADQIHSVDKAIEYILRQPDAH |
|
PDB | 7zmb Conformational changes in mitochondrial complex I of the thermophilic eukaryote Chaetomium thermophilum. |
Chain | Q |
Resolution | 2.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZMP |
Q |
S98 L99 |
S42 L43 |
|
|
|
|