Structure of PDB 7ze8 Chain Q

Receptor sequence
>7ze8Q (length=48) Species: 1076 (Rhodopseudomonas palustris) [Search protein sequence]
MNQGRIWTVVKPTVGLPLLLGSVTVIAILVHFAVLSNTTWFSKYWNGK
3D structure
PDB7ze8 Cryo-EM structures of light-harvesting 2 complexes from Rhodopseudomonas palustris reveal the molecular origin of absorption tuning.
ChainQ
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL Q L19 S22 L19 S22
BS02 IRM Q L20 V23 I26 L20 V23 I26
BS03 IRM Q Q3 I6 Q3 I6
BS04 IRM Q H31 F32 H31 F32
BS05 BCL Q Y44 W45 Y44 W45
BS06 BCL Q T24 H31 W40 F41 W45 T24 H31 W40 F41 W45
BS07 BCL Q V23 A27 V30 H31 V23 A27 V30 H31
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ze8, PDBe:7ze8, PDBj:7ze8
PDBsum7ze8
PubMed36251992
UniProtP35105|LHA5_RHOPA Light-harvesting protein B-800-850 alpha chain E (Gene Name=pucAE)

[Back to BioLiP]