Structure of PDB 7v9c Chain Q |
>7v9cQ (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] |
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEIL ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQA VLLPK |
|
PDB | 7v9c Columnar structure of human telomeric chromatin. |
Chain | Q |
Resolution | 4.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
Q |
R29 R42 |
R16 R29 |
|
|
|
|